PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004510895.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 28169.1 Da    PI: 9.1137
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004510895.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.28e-32958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  XP_004510895.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                    79**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.445161IPR002100Transcription factor, MADS-box
CDDcd002651.16E-45273No hitNo description
SuperFamilySSF554551.83E-33280IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-3086171IPR002487Transcription factor, K-box
PROSITE profilePS5129716.84387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010094Biological Processspecification of carpel identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSV  60
GTTKTIERYQ RCSFNPQPDD HQIDCETQSW YQEVSKLKAK YESLQRTQRH LLGEDLGPLN  120
IKELQSLEKQ LEGALAQARQ RKTQIMIEQM EELRKRERHL GDMNKQLRLK LEGEGFNLKA  180
MEWSSTSAAG NTNFTFQQPQ TNPMDMQAEP FLQIGYQQYV QAEASNISKS MACETNFMQG  240
WML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-238917119101Developmental protein SEPALLATA 3
4ox0_B3e-238917119101Developmental protein SEPALLATA 3
4ox0_C3e-238917119101Developmental protein SEPALLATA 3
4ox0_D3e-238917119101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8842890.0AY884289.1 Pisum sativum MADS box protein M5 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004510895.10.0PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU391e-113MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLA0A072TNM91e-167A0A072TNM9_MEDTR; MADS-box transcription factor
STRINGGLYMA07G08890.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-112AGAMOUS-like 6